Recombinant Human ALG6 Protein, GST-tagged

Cat.No. : ALG6-466H
Product Overview : Human ALG6 partial ORF ( NP_037471, 25 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.64 kDa
AA Sequence : SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALG6 asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ALG6
Synonyms ALG6; asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 6 homolog (yeast, alpha 1,3 glucosyltransferase); dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; asparagine-linked glycosylation protein 6 homolog; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1C;
Gene ID 29929
mRNA Refseq NM_013339
Protein Refseq NP_037471
MIM 604566
UniProt ID Q9Y672

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALG6 Products

Required fields are marked with *

My Review for All ALG6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon