Recombinant Human ALG6 Protein, GST-tagged
| Cat.No. : | ALG6-466H |
| Product Overview : | Human ALG6 partial ORF ( NP_037471, 25 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALG6 asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ALG6 |
| Synonyms | ALG6; asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 6 homolog (yeast, alpha 1,3 glucosyltransferase); dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; asparagine-linked glycosylation protein 6 homolog; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1C; |
| Gene ID | 29929 |
| mRNA Refseq | NM_013339 |
| Protein Refseq | NP_037471 |
| MIM | 604566 |
| UniProt ID | Q9Y672 |
| ◆ Recombinant Proteins | ||
| ALG6-466H | Recombinant Human ALG6 Protein, GST-tagged | +Inquiry |
| ALG6-286R | Recombinant Rat ALG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALG6-469M | Recombinant Mouse ALG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALG6-1117Z | Recombinant Zebrafish ALG6 | +Inquiry |
| ALG6-6005C | Recombinant Chicken ALG6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG6 Products
Required fields are marked with *
My Review for All ALG6 Products
Required fields are marked with *



