Recombinant Human ALG8 Protein, GST-tagged
| Cat.No. : | ALG8-467H |
| Product Overview : | Human ALG8 partial ORF ( NP_076984, 260 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 33.99 kDa |
| AA Sequence : | NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALG8 asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ALG8 |
| Synonyms | ALG8; asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 8 homolog (yeast, alpha 1,3 glucosyltransferase); probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase; MGC2840; HUSSY-02; asparagine-linked glycosylation protein 8 homolog; dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase; dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase; dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase; dolichyl-P-glucose:Glc1Man9GlcNAc2-PP-dolichyl-alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 8 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 8 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1H; |
| Gene ID | 79053 |
| mRNA Refseq | NM_001007027 |
| Protein Refseq | NP_001007028 |
| MIM | 608103 |
| UniProt ID | Q9BVK2 |
| ◆ Recombinant Proteins | ||
| ALG8-2415Z | Recombinant Zebrafish ALG8 | +Inquiry |
| ALG8-470M | Recombinant Mouse ALG8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALG8-467H | Recombinant Human ALG8 Protein, GST-tagged | +Inquiry |
| RFL17415PF | Recombinant Full Length Pseudomonas Putida Glycosyltransferase Alg8(Alg8) Protein, His-Tagged | +Inquiry |
| ALG8-1550M | Recombinant Mouse ALG8 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALG8-8905HCL | Recombinant Human ALG8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG8 Products
Required fields are marked with *
My Review for All ALG8 Products
Required fields are marked with *
