Recombinant Human ALOX15B
Cat.No. : | ALOX15B-26021TH |
Product Overview : | Recombinant fragment of Human 15 Lipoxygenase 2 with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in hair, prostate, lung and cornea. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA |
Sequence Similarities : | Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain. |
Gene Name | ALOX15B arachidonate 15-lipoxygenase, type B [ Homo sapiens ] |
Official Symbol | ALOX15B |
Synonyms | ALOX15B; arachidonate 15-lipoxygenase, type B; arachidonate 15 lipoxygenase, second type; arachidonate 15-lipoxygenase B; 15 LOX 2; |
Gene ID | 247 |
mRNA Refseq | NM_001039130 |
Protein Refseq | NP_001034219 |
MIM | 603697 |
Uniprot ID | O15296 |
Chromosome Location | 17p13.1 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Selenium Pathway, organism-specific biosystem; |
Function | arachidonate 15-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
Alox15b-6850R | Recombinant Rat Alox15b protein, His & T7-tagged | +Inquiry |
ALOX15B-26021TH | Recombinant Human ALOX15B | +Inquiry |
ALOX15B-40H | Recombinant Human ALOX15B Protein, His-tagged | +Inquiry |
ALOX15B-1480HF | Recombinant Full Length Human ALOX15B Protein, GST-tagged | +Inquiry |
ALOX15B-3241H | Recombinant Human ALOX15B protein(Met1-Ile676) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX15B-002HCL | Recombinant Human ALOX15B cell lysate | +Inquiry |
ALOX15B-001HCL | Recombinant Human ALOX15B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALOX15B Products
Required fields are marked with *
My Review for All ALOX15B Products
Required fields are marked with *