Recombinant Human ALOX15B

Cat.No. : ALOX15B-26021TH
Product Overview : Recombinant fragment of Human 15 Lipoxygenase 2 with N terminal proprietary tag, 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in hair, prostate, lung and cornea.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
Sequence Similarities : Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name ALOX15B arachidonate 15-lipoxygenase, type B [ Homo sapiens ]
Official Symbol ALOX15B
Synonyms ALOX15B; arachidonate 15-lipoxygenase, type B; arachidonate 15 lipoxygenase, second type; arachidonate 15-lipoxygenase B; 15 LOX 2;
Gene ID 247
mRNA Refseq NM_001039130
Protein Refseq NP_001034219
MIM 603697
Uniprot ID O15296
Chromosome Location 17p13.1
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Selenium Pathway, organism-specific biosystem;
Function arachidonate 15-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALOX15B Products

Required fields are marked with *

My Review for All ALOX15B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon