Recombinant Human ALPI Protein (20-503 aa), His-tagged

Cat.No. : ALPI-1326H
Product Overview : Recombinant Human ALPI Protein (20-503 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 20-503 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 54.4 kDa
AA Sequence : VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ALPI alkaline phosphatase, intestinal [ Homo sapiens ]
Official Symbol ALPI
Synonyms ALPI; Kasahara isozyme; glycerophosphatase; IAP;
Gene ID 248
mRNA Refseq NM_001631
Protein Refseq NP_001622
MIM 171740
UniProt ID P09923

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALPI Products

Required fields are marked with *

My Review for All ALPI Products

Required fields are marked with *

0
cart-icon
0
compare icon