Recombinant Human ALPI Protein (20-503 aa), His-tagged
| Cat.No. : | ALPI-1326H |
| Product Overview : | Recombinant Human ALPI Protein (20-503 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 20-503 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 54.4 kDa |
| AA Sequence : | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens ] |
| Official Symbol | ALPI |
| Synonyms | ALPI; Kasahara isozyme; glycerophosphatase; IAP; |
| Gene ID | 248 |
| mRNA Refseq | NM_001631 |
| Protein Refseq | NP_001622 |
| MIM | 171740 |
| UniProt ID | P09923 |
| ◆ Recombinant Proteins | ||
| Alpi-654R | Recombinant Rat Alpi protein(21-511aa), His-tagged | +Inquiry |
| ALPI-514H | Active Recombinant Human ALPI Protein, His-tagged | +Inquiry |
| ALPI-3670H | Recombinant Human ALPI protein, rFc-tagged | +Inquiry |
| ALPI-122H | Recombinant Human ALPI Protein, His-tagged | +Inquiry |
| ALPI-513H | Active Recombinant Human ALPI Protein, Fc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
| IAP-8323C | Active Native Bovine IAP | +Inquiry |
| ALPI-8341C | Native Calf ALPI | +Inquiry |
| ALPI-8348B | Native Bovine ALPI | +Inquiry |
| BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPI-471HKCL | Human ALPI Knockdown Cell Lysate | +Inquiry |
| ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *
