Recombinant Human ALPI Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | ALPI-024H |
Product Overview : | ALPI MS Standard C13 and N15-labeled recombinant protein (NP_001622) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. |
Molecular Mass : | 56.81 kDa |
AA Sequence : | MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens (human) ] |
Official Symbol | ALPI |
Synonyms | ALPI alkaline phosphatase, intestinal; IAP; intestinal-type alkaline phosphatase; Kasahara isozyme; alkaline phosphomonoesterase; glycerophosphatase; intestinal alkaline phosphatase; EC 3.1.3.1 |
Gene ID | 248 |
mRNA Refseq | NM_001631 |
Protein Refseq | NP_001622 |
MIM | 171740 |
UniProt ID | P09923 |
◆ Recombinant Proteins | ||
ALPI-1117H | Recombinant Human ALPI Protein, His-tagged | +Inquiry |
ALPI-490H | Recombinant Human ALPI Protein, GST-tagged | +Inquiry |
ALPI-024H | Recombinant Human ALPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALPI-326H | Recombinant Human ALPI Protein, His (Fc)-Avi-tagged | +Inquiry |
ALPI-3670H | Recombinant Human ALPI protein, rFc-tagged | +Inquiry |
◆ Native Proteins | ||
ALPI-8341C | Native Calf ALPI | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *