Recombinant Human ALPK1 protein, His-tagged
| Cat.No. : | ALPK1-3097H |
| Product Overview : | Recombinant Human ALPK1 protein(1-347 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-347 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ALPK1 alpha-kinase 1 [ Homo sapiens ] |
| Official Symbol | ALPK1 |
| Synonyms | ALPK1; alpha-kinase 1; alpha-protein kinase 1; FLJ22670; KIAA1527; Lak; lymphocyte alpha kinase; chromosome 4 kinase; lymphocyte alpha-kinase; lymphocyte alpha-protein kinase; LAK; 8430410J10Rik; |
| Gene ID | 80216 |
| mRNA Refseq | NM_001102406 |
| Protein Refseq | NP_001095876 |
| MIM | 607347 |
| UniProt ID | Q96QP1 |
| ◆ Recombinant Proteins | ||
| ALPK1-394HFL | Recombinant Full Length Human ALPK1 Protein, C-Flag-tagged | +Inquiry |
| ALPK1-001H | Recombinant Human ALPK1 Protein, Myc/DDK-tagged | +Inquiry |
| ALPK1-5985H | Recombinant Human ALPK1 protein, His&Myc-tagged | +Inquiry |
| ALPK1-3097H | Recombinant Human ALPK1 protein, His-tagged | +Inquiry |
| ALPK1-327H | Recombinant Human ALPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPK1-8894HCL | Recombinant Human ALPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPK1 Products
Required fields are marked with *
My Review for All ALPK1 Products
Required fields are marked with *
