Recombinant Human ALPK1 protein, His-tagged
Cat.No. : | ALPK1-3097H |
Product Overview : | Recombinant Human ALPK1 protein(1-347 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-347 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ALPK1 alpha-kinase 1 [ Homo sapiens ] |
Official Symbol | ALPK1 |
Synonyms | ALPK1; alpha-kinase 1; alpha-protein kinase 1; FLJ22670; KIAA1527; Lak; lymphocyte alpha kinase; chromosome 4 kinase; lymphocyte alpha-kinase; lymphocyte alpha-protein kinase; LAK; 8430410J10Rik; |
Gene ID | 80216 |
mRNA Refseq | NM_001102406 |
Protein Refseq | NP_001095876 |
MIM | 607347 |
UniProt ID | Q96QP1 |
◆ Recombinant Proteins | ||
ALPK1-001H | Recombinant Human ALPK1 Protein, Myc/DDK-tagged | +Inquiry |
ALPK1-5985H | Recombinant Human ALPK1 protein, His&Myc-tagged | +Inquiry |
ALPK1-2177H | Recombinant Human ALPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALPK1-491H | Recombinant Human ALPK1 Protein, GST-tagged | +Inquiry |
ALPK1-3097H | Recombinant Human ALPK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPK1-8894HCL | Recombinant Human ALPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPK1 Products
Required fields are marked with *
My Review for All ALPK1 Products
Required fields are marked with *