Recombinant Human ALPP protein, His-tagged

Cat.No. : ALPP-2511H
Product Overview : Recombinant Human ALPP protein(P05187)(117-447aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 117-447aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.9 kDa
AA Sequence : TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ALPP alkaline phosphatase, placental [ Homo sapiens ]
Official Symbol ALPP
Synonyms ALPP; alkaline phosphatase, placental; alkaline phosphatase, placental (Regan isozyme); alkaline phosphatase, placental type; Regan isozyme; PLAP-1; glycerophosphatase; alkaline phosphomonoesterase; placental alkaline phosphatase 1; alkaline phosphatase Regan isozyme; ALP; PALP; PLAP; FLJ61142;
Gene ID 250
mRNA Refseq NM_001632
Protein Refseq NP_001623
MIM 171800
UniProt ID P05187

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALPP Products

Required fields are marked with *

My Review for All ALPP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon