Recombinant Human AMACR, GST-tagged
| Cat.No. : | AMACR-111H |
| Product Overview : | Recombinant Human AMACR (1 a.a. - 198 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. |
| Molecular Mass : | 47.52 kDa |
| Sequence : | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV |
| Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | AMACR |
| Gene Name | AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ] |
| Synonyms | AMACR; RACE; CBAS4; AMACRD; alpha-methylacyl-CoA racemase; EC 5.1.99.4; 2-methylacyl-CoA racemase |
| Gene ID | 23600 |
| mRNA Refseq | NM_014324 |
| Protein Refseq | NP_055139 |
| MIM | 604489 |
| UniProt ID | Q9UHK6 |
| Chromosome Location | 5p13 |
| Pathway | Metabolic pathways; Primary bile acid biosynthesis; Metabolism of lipids and lipoproteins |
| Function | alpha-methylacyl-CoA racemase activity; receptor binding |
| ◆ Recombinant Proteins | ||
| Amacr-3378M | Recombinant Mouse Amacr, His-tagged | +Inquiry |
| AMACR-111H | Recombinant Human AMACR, GST-tagged | +Inquiry |
| AMACR-497M | Recombinant Mouse AMACR Protein, His (Fc)-Avi-tagged | +Inquiry |
| AMACR-106H | Recombinant Human AMACR, MYC/DDK-tagged | +Inquiry |
| AMACR-330H | Recombinant Human AMACR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMACR Products
Required fields are marked with *
My Review for All AMACR Products
Required fields are marked with *
