Recombinant Human AMACR, GST-tagged

Cat.No. : AMACR-111H
Product Overview : Recombinant Human AMACR (1 a.a. - 198 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Molecular Mass : 47.52 kDa
Sequence : MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : AMACR
Gene Name AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ]
Synonyms AMACR; RACE; CBAS4; AMACRD; alpha-methylacyl-CoA racemase; EC 5.1.99.4; 2-methylacyl-CoA racemase
Gene ID 23600
mRNA Refseq NM_014324
Protein Refseq NP_055139
MIM 604489
UniProt ID Q9UHK6
Chromosome Location 5p13
Pathway Metabolic pathways; Primary bile acid biosynthesis; Metabolism of lipids and lipoproteins
Function alpha-methylacyl-CoA racemase activity; receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMACR Products

Required fields are marked with *

My Review for All AMACR Products

Required fields are marked with *

0
cart-icon