Recombinant Human AMACR, GST-tagged
Cat.No. : | AMACR-111H |
Product Overview : | Recombinant Human AMACR (1 a.a. - 198 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. |
Molecular Mass : | 47.52 kDa |
Sequence : | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV |
Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | AMACR |
Gene Name | AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ] |
Synonyms | AMACR; RACE; CBAS4; AMACRD; alpha-methylacyl-CoA racemase; EC 5.1.99.4; 2-methylacyl-CoA racemase |
Gene ID | 23600 |
mRNA Refseq | NM_014324 |
Protein Refseq | NP_055139 |
MIM | 604489 |
UniProt ID | Q9UHK6 |
Chromosome Location | 5p13 |
Pathway | Metabolic pathways; Primary bile acid biosynthesis; Metabolism of lipids and lipoproteins |
Function | alpha-methylacyl-CoA racemase activity; receptor binding |
◆ Recombinant Proteins | ||
AMACR-497M | Recombinant Mouse AMACR Protein, His (Fc)-Avi-tagged | +Inquiry |
AMACR-0408H | Recombinant Human AMACR Protein (Met1-Gly131), N-His-tagged | +Inquiry |
AMACR-3096C | Recombinant Chicken AMACR | +Inquiry |
Amacr-3378M | Recombinant Mouse Amacr, His-tagged | +Inquiry |
AMACR-107H | Recombinant Human AMACR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMACR Products
Required fields are marked with *
My Review for All AMACR Products
Required fields are marked with *
0
Inquiry Basket