Recombinant Human AMACR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AMACR-6692H |
Product Overview : | AMACR MS Standard C13 and N15-labeled recombinant protein (NP_055139) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTDKGQVIDANMVEGTAYLSSFLWKTQKSSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASLSGPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AMACR alpha-methylacyl-CoA racemase [ Homo sapiens (human) ] |
Official Symbol | AMACR |
Synonyms | AMACR; alpha-methylacyl-CoA racemase; RACE; 2-methylacyl-CoA racemase; RM; CBAS4; AMACRD; |
Gene ID | 23600 |
mRNA Refseq | NM_014324 |
Protein Refseq | NP_055139 |
MIM | 604489 |
UniProt ID | Q9UHK6 |
◆ Recombinant Proteins | ||
AMACR-106H | Recombinant Human AMACR, MYC/DDK-tagged | +Inquiry |
AMACR-257HFL | Active Recombinant Full Length Human AMACR Protein, C-Flag-tagged | +Inquiry |
AMACR-0409H | Recombinant Human AMACR Protein, His-tagged | +Inquiry |
AMACR-497M | Recombinant Mouse AMACR Protein, His (Fc)-Avi-tagged | +Inquiry |
Amacr-1607M | Recombinant Mouse Amacr Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMACR Products
Required fields are marked with *
My Review for All AMACR Products
Required fields are marked with *
0
Inquiry Basket