Recombinant Human AMELY Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AMELY-457H
• Product Overview: AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.
• Molecular Mass: 21.73 kDa
• AA Sequence: MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AMELY amelogenin Y-linked [ Homo sapiens (human) ]
• Official Symbol: AMELY
• Synonyms: Amelogenin (Y chromosome); Amelogenin; Amelogenin Y isoform; Amelogenin Y linked; AMELY; AMELY_HUMAN; AMGL; AMGY; Y isoform; AMELY
• Gene ID: 266
• mRNA Refseq: NM_001143
• Protein Refseq: NP_001134
• MIM: 410000
• UniProt ID: Q99218