Recombinant Human AMID protein, GST-tagged
| Cat.No. : | AMID-523H |
| Product Overview : | Human AMID partial ORF ( NP_116186, 188 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AIFM2 apoptosis inducing factor, mitochondria associated 2 [ Homo sapiens (human) ] |
| Official Symbol | AIFM2 |
| Synonyms | AIFM2; apoptosis inducing factor, mitochondria associated 2; AMID; PRG3; apoptosis-inducing factor 2; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor, mitochondrion-associated, 2; p53-responsive gene 3 protein |
| Gene ID | 84883 |
| mRNA Refseq | NM_001198696 |
| Protein Refseq | NP_001185625 |
| MIM | 605159 |
| UniProt ID | Q9BRQ8 |
| ◆ Cell & Tissue Lysates | ||
| AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM2 Products
Required fields are marked with *
My Review for All AIFM2 Products
Required fields are marked with *



