Recombinant Human AMN protein, GST-tagged
Cat.No. : | AMN-7744H |
Product Overview : | Recombinant Human AMN protein(20-204 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 20-204 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPED |
Gene Name | AMN amnionless homolog (mouse) [ Homo sapiens ] |
Official Symbol | AMN |
Synonyms | AMN; amnionless homolog (mouse); protein amnionless; visceral endoderm-specific type 1 transmembrane protein; PRO1028; |
Gene ID | 81693 |
mRNA Refseq | NM_030943 |
Protein Refseq | NP_112205 |
MIM | 605799 |
UniProt ID | Q9BXJ7 |
◆ Recombinant Proteins | ||
AMN-4907C | Recombinant Chicken AMN | +Inquiry |
AMN-2462H | Recombinant Human AMN Protein, His (Fc)-Avi-tagged | +Inquiry |
AMN-777H | Active Recombinant Human AMN Protein, His-tagged | +Inquiry |
Amn-136R | Recombinant Rat Amn Protein, His-tagged | +Inquiry |
AMN-7744H | Recombinant Human AMN protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMN Products
Required fields are marked with *
My Review for All AMN Products
Required fields are marked with *
0
Inquiry Basket