Recombinant Human AMOTL2 protein, His-tagged
| Cat.No. : | AMOTL2-84654H | 
| Product Overview : | Recombinant Human AMOTL2 protein(340-466 aa), fused with N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 340-466 aa | 
| Tag : | N-His | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. | 
| AA Sequence : | DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI | 
| Gene Name | AMOTL2 angiomotin like 2 [ Homo sapiens ] | 
| Official Symbol | AMOTL2 | 
| Synonyms | LCCP | 
| Gene ID | 51421 | 
| mRNA Refseq | NM_016201.2 | 
| Protein Refseq | NP_057285.3 | 
| MIM | 614658 | 
| UniProt ID | Q9Y2J4 | 
| ◆ Recombinant Proteins | ||
| AMOTL2-656R | Recombinant Rat AMOTL2 Protein | +Inquiry | 
| AMOTL2-1283HF | Recombinant Full Length Human AMOTL2 Protein, GST-tagged | +Inquiry | 
| AMOTL2-529H | Recombinant Human AMOTL2 protein, GST-tagged | +Inquiry | 
| AMOTL2-3405H | Recombinant Human AMOTL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| AMOTL2-1606M | Recombinant Mouse AMOTL2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AMOTL2-19HCL | Recombinant Human AMOTL2 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMOTL2 Products
Required fields are marked with *
My Review for All AMOTL2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            