Recombinant Human ANAC protein, GST-tagged

• Cat.No.: ANAC-539H
• Product Overview: Human ANAC partial ORF ( NP_954984, 116 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NACA2 (Nascent Polypeptide Associated Complex Alpha Subunit 2) is a Protein Coding gene. An important paralog of this gene is NACA.
• Molecular Mass: 36.74 kDa
• AA Sequence: ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NACA2 nascent polypeptide associated complex alpha subunit 2 [ Homo sapiens (human) ]
• Official Symbol: NACA2
• Synonyms: NACA2; nascent polypeptide associated complex alpha subunit 2; ANAC; NACAL; nascent polypeptide-associated complex subunit alpha-2; IgE autoantigen alpha-nascent polypeptide-associated complex; alpha-NAC protein; hom s 2.01 protein; nascent polypeptide-associated complex, alpha polypeptide, 2
• Gene ID: 342538
• mRNA Refseq: NM_199290
• Protein Refseq: NP_954984
• MIM: 609274
• UniProt ID: Q9H009