Recombinant Human ANAC protein, GST-tagged

Cat.No. : ANAC-539H
Product Overview : Human ANAC partial ORF ( NP_954984, 116 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NACA2 (Nascent Polypeptide Associated Complex Alpha Subunit 2) is a Protein Coding gene. An important paralog of this gene is NACA.
Molecular Mass : 36.74 kDa
AA Sequence : ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NACA2 nascent polypeptide associated complex alpha subunit 2 [ Homo sapiens (human) ]
Official Symbol NACA2
Synonyms NACA2; nascent polypeptide associated complex alpha subunit 2; ANAC; NACAL; nascent polypeptide-associated complex subunit alpha-2; IgE autoantigen alpha-nascent polypeptide-associated complex; alpha-NAC protein; hom s 2.01 protein; nascent polypeptide-associated complex, alpha polypeptide, 2
Gene ID 342538
mRNA Refseq NM_199290
Protein Refseq NP_954984
MIM 609274
UniProt ID Q9H009

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NACA2 Products

Required fields are marked with *

My Review for All NACA2 Products

Required fields are marked with *

0
cart-icon