Recombinant Human NACA2
Cat.No. : | NACA2-28774TH |
Product Overview : | Recombinant full length protein , mw 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | NACA2, Nascent polypeptide associated complex subunit alpha 2, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER) by binding to nascent polypeptide chains as they emerge from the ribosome and blocking their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. NACA2 also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites). |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Store at -20oC. |
Sequences of amino acids : | MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEE QDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRARK AMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPA SDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQEN TQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAK AVRALKNNSNDIVNAIMELTV |
Full Length : | Full L. |
Gene Name | NACA2 nascent polypeptide-associated complex alpha subunit 2 [ Homo sapiens ] |
Official Symbol | NACA2 |
Synonyms | NACA2; nascent polypeptide-associated complex alpha subunit 2; NACAL, nascent polypeptide associated complex alpha polypeptide like; nascent polypeptide-associated complex subunit alpha-2; alpha NAC protein; MGC71999; |
Gene ID | 342538 |
mRNA Refseq | NM_199290 |
Protein Refseq | NP_954984 |
MIM | 609274 |
Uniprot ID | Q9H009 |
Chromosome Location | 17q23.3 |
◆ Recombinant Proteins | ||
NACA2-28774TH | Recombinant Human NACA2 | +Inquiry |
ANAC-539H | Recombinant Human ANAC protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NACA2-3987HCL | Recombinant Human NACA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NACA2 Products
Required fields are marked with *
My Review for All NACA2 Products
Required fields are marked with *