Recombinant Human ANAPC5 Protein (2-232 aa), GST-tagged
Cat.No. : | ANAPC5-1211H |
Product Overview : | Recombinant Human ANAPC5 Protein (2-232 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Cycle. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-232 aa |
Description : | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.2 kDa |
AA Sequence : | ASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ANAPC5 anaphase promoting complex subunit 5 [ Homo sapiens ] |
Official Symbol | ANAPC5 |
Synonyms | ANAPC5; APC5; cyclosome subunit 5; |
Gene ID | 51433 |
mRNA Refseq | NM_001137559 |
Protein Refseq | NP_001131031 |
MIM | 606948 |
UniProt ID | Q9UJX4 |
◆ Recombinant Proteins | ||
ANAPC5-6875H | Recombinant Human ANAPC5 protein, GST-tagged | +Inquiry |
ANAPC5-1336C | Recombinant Chicken ANAPC5 | +Inquiry |
ANAPC5-5122H | Recombinant Human ANAPC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANAPC5-546H | Recombinant Human ANAPC5 protein, GST-tagged | +Inquiry |
ANAPC5-339H | Recombinant Human ANAPC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC5-74HCL | Recombinant Human ANAPC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANAPC5 Products
Required fields are marked with *
My Review for All ANAPC5 Products
Required fields are marked with *
0
Inquiry Basket