Recombinant Human ANAPC5 protein, GST-tagged
Cat.No. : | ANAPC5-6875H |
Product Overview : | Recombinant Human ANAPC5 protein(1-343 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-343 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHC |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ANAPC5 anaphase promoting complex subunit 5 [ Homo sapiens ] |
Official Symbol | ANAPC5 |
Synonyms | ANAPC5; anaphase promoting complex subunit 5; anaphase-promoting complex subunit 5; APC5; cyclosome subunit 5; |
mRNA Refseq | NM_001137559 |
Protein Refseq | NP_001131031 |
MIM | 606948 |
UniProt ID | Q9UJX4 |
Gene ID | 51433 |
◆ Recombinant Proteins | ||
ANAPC5-6875H | Recombinant Human ANAPC5 protein, GST-tagged | +Inquiry |
ANAPC5-1211H | Recombinant Human ANAPC5 Protein (2-232 aa), GST-tagged | +Inquiry |
ANAPC5-1285HF | Recombinant Full Length Human ANAPC5 Protein, GST-tagged | +Inquiry |
ANAPC5-9639H | Recombinant Human ANAPC5 protein, His-tagged | +Inquiry |
ANAPC5-339H | Recombinant Human ANAPC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC5-74HCL | Recombinant Human ANAPC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANAPC5 Products
Required fields are marked with *
My Review for All ANAPC5 Products
Required fields are marked with *
0
Inquiry Basket