Recombinant Human ANAPC5 protein, GST-tagged
| Cat.No. : | ANAPC5-6875H |
| Product Overview : | Recombinant Human ANAPC5 protein(1-343 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-343 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHC |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | ANAPC5 anaphase promoting complex subunit 5 [ Homo sapiens ] |
| Official Symbol | ANAPC5 |
| Synonyms | ANAPC5; anaphase promoting complex subunit 5; anaphase-promoting complex subunit 5; APC5; cyclosome subunit 5; |
| mRNA Refseq | NM_001137559 |
| Protein Refseq | NP_001131031 |
| MIM | 606948 |
| UniProt ID | Q9UJX4 |
| Gene ID | 51433 |
| ◆ Recombinant Proteins | ||
| ANAPC5-5122H | Recombinant Human ANAPC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Anapc5-1622M | Recombinant Mouse Anapc5 Protein, Myc/DDK-tagged | +Inquiry |
| ANAPC5-2085H | Recombinant Human ANAPC5 Protein, MYC/DDK-tagged | +Inquiry |
| ANAPC5-1211H | Recombinant Human ANAPC5 Protein (2-232 aa), GST-tagged | +Inquiry |
| ANAPC5-628HFL | Recombinant Full Length Human ANAPC5 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANAPC5-74HCL | Recombinant Human ANAPC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC5 Products
Required fields are marked with *
My Review for All ANAPC5 Products
Required fields are marked with *



