Recombinant Human ANGPT1/COMP protein, FLAG-tagged

Cat.No. : ANGPT1-35H
Product Overview : Recombinant Human ANGPT1(256–498 (end)) fused with FLAG tag at N-terminal and Mouse COMP(28–72) was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : 256-498 a.a.
Form : 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.05% Tween-20, 100 ng/µl FLAG peptide, 20% glycerol, and 1 mM DTT.
Molecular Mass : 34 kDa
AA Sequence : DYKDDDDKDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACGDTVHNLVNLCTKEGVLLKGGKR EEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNP SGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFS TKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Purity : >90%
Applications : Useful for the study of signaling pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling.
Storage : >6 months at –80 centigrade. Avoid freeze/thaw cycles.
Gene Name ANGPT1 angiopoietin 1 [ Homo sapiens ]
Official Symbol ANGPT1
Synonyms ANGPT1; angiopoietin 1; angiopoietin-1; Ang1; KIAA0003; ANG-1; AGP1; AGPT; ANG1;
Gene ID 284
mRNA Refseq NM_001146
Protein Refseq NP_001137
MIM 601667
UniProt ID Q15389
Chromosome Location 8q23.1
Pathway Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; Tie2 Signaling, organism-specific biosystem;
Function receptor tyrosine kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPT1 Products

Required fields are marked with *

My Review for All ANGPT1 Products

Required fields are marked with *

0
cart-icon