"ANGPT1" Related Products

Expand
Expand

Recombinant Human ANGPT1/COMP protein, FLAG-tagged

Cat.No.: ANGPT1-35H
Product Overview: Recombinant Human ANGPT1(256–498 (end)) fused with FLAG tag at N-terminal and Mouse COMP(28–72) was expressed in HEK293.
Source: HEK293
Species: Human
Tag: FLAG
Form: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.05% Tween-20, 100 ng/µl FLAG peptide, 20% glycerol, and 1 mM DTT.
Molecular Mass: 34 kDa
AA Sequence: DYKDDDDKDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACGDTVHNLVNLCTKEGVLLKGGKR EEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNP SGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFS TKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Purity: >90%
Applications: Useful for the study of signaling pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling.
Storage: >6 months at –80 centigrade. Avoid freeze/thaw cycles.
Gene Name: ANGPT1 angiopoietin 1 [ Homo sapiens ]
Official Symbol: ANGPT1
Synonyms: ANGPT1; angiopoietin 1; angiopoietin-1; Ang1; KIAA0003; ANG-1; AGP1; AGPT; ANG1;
Gene ID: 284
mRNA Refseq: NM_001146
Protein Refseq: NP_001137
MIM: 601667
UniProt ID: Q15389
Chromosome Location: 8q23.1
Pathway: Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem; Tie2 Signaling, organism-specific biosystem;
Function: receptor tyrosine kinase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.