Recombinant Human ANGPT2 Protein, His-tagged

Cat.No. : ANGPT2-388H
Product Overview : Recombinant Human ANGPT2, transcript variant 1,fused with His tag at N-terminal was expressed in CHO cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Description : The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Molecular Mass : 56.95 kDa
AA Sequence : DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name ANGPT2 angiopoietin 2 [ Homo sapiens ]
Official Symbol ANGPT2
Synonyms ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2;
Gene ID 285
mRNA Refseq NM_001118887
Protein Refseq NP_001112359
MIM 601922
UniProt ID O15123

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPT2 Products

Required fields are marked with *

My Review for All ANGPT2 Products

Required fields are marked with *

0
cart-icon