Recombinant Human ANGPT2 Protein, His-tagged
Cat.No. : | ANGPT2-388H |
Product Overview : | Recombinant Human ANGPT2, transcript variant 1,fused with His tag at N-terminal was expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Description : | The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 56.95 kDa |
AA Sequence : | DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | ANGPT2 angiopoietin 2 [ Homo sapiens ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2; |
Gene ID | 285 |
mRNA Refseq | NM_001118887 |
Protein Refseq | NP_001112359 |
MIM | 601922 |
UniProt ID | O15123 |
◆ Recombinant Proteins | ||
ANGPT2-537R | Recombinant Rabbit ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-200H | Active Recombinant Human ANGPT2 protein, hFc-tagged | +Inquiry |
ANGPT2-315R | Active Recombinant Rabbit ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-5226H | Recombinant Human ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-013H | Recombinant Human ANGPT2 Protein, TYR19-PHE496, Tag Free, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *