Recombinant Human ANK3 protein, His-tagged
| Cat.No. : | ANK3-5633H | 
| Product Overview : | Recombinant Human ANK3 protein(Q12955)(4088-4199aa), fused with C-terminal His tag, was expressed in Yeast. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Yeast | 
| Tag : | His | 
| Protein Length : | 4088-4199aa | 
| Tag : | C-His | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 14.1 kDa | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG | 
| Gene Name | ANK3 ankyrin 3, node of Ranvier (ankyrin G) [ Homo sapiens ] | 
| Official Symbol | ANK3 | 
| Synonyms | ANK3; ankyrin 3, node of Ranvier (ankyrin G); ankyrin-3; ankyrin 3; node of Ranvier; ankyrin G; ankyrin G119; ANKYRIN-G; FLJ45464; | 
| Gene ID | 288 | 
| mRNA Refseq | NM_001149 | 
| Protein Refseq | NP_001140 | 
| MIM | 600465 | 
| UniProt ID | Q12955 | 
| ◆ Recombinant Proteins | ||
| ANK3-154H | Recombinant Human ANK3 Protein, His-tagged | +Inquiry | 
| ANK3-3181H | Recombinant Human ANK3 protein, His-tagged | +Inquiry | 
| ANK3-671R | Recombinant Rat ANK3 Protein | +Inquiry | 
| ANK3-4719C | Recombinant Chicken ANK3 | +Inquiry | 
| ANK3-2873H | Recombinant Human ANK3 protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANK3 Products
Required fields are marked with *
My Review for All ANK3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            