Recombinant Human ANK3 protein, His-tagged

Cat.No. : ANK3-5633H
Product Overview : Recombinant Human ANK3 protein(Q12955)(4088-4199aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 4088-4199aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 14.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
Gene Name ANK3 ankyrin 3, node of Ranvier (ankyrin G) [ Homo sapiens ]
Official Symbol ANK3
Synonyms ANK3; ankyrin 3, node of Ranvier (ankyrin G); ankyrin-3; ankyrin 3; node of Ranvier; ankyrin G; ankyrin G119; ANKYRIN-G; FLJ45464;
Gene ID 288
mRNA Refseq NM_001149
Protein Refseq NP_001140
MIM 600465
UniProt ID Q12955

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANK3 Products

Required fields are marked with *

My Review for All ANK3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon