Recombinant Human ANK3 protein, His-tagged
Cat.No. : | ANK3-5633H |
Product Overview : | Recombinant Human ANK3 protein(Q12955)(4088-4199aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 4088-4199aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG |
Gene Name | ANK3 ankyrin 3, node of Ranvier (ankyrin G) [ Homo sapiens ] |
Official Symbol | ANK3 |
Synonyms | ANK3; ankyrin 3, node of Ranvier (ankyrin G); ankyrin-3; ankyrin 3; node of Ranvier; ankyrin G; ankyrin G119; ANKYRIN-G; FLJ45464; |
Gene ID | 288 |
mRNA Refseq | NM_001149 |
Protein Refseq | NP_001140 |
MIM | 600465 |
UniProt ID | Q12955 |
◆ Recombinant Proteins | ||
ANK3-3181H | Recombinant Human ANK3 protein, His-tagged | +Inquiry |
ANK3-327R | Recombinant Rat ANK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANK3-3243H | Recombinant Human ANK3 protein, His-tagged | +Inquiry |
ANK3-671R | Recombinant Rat ANK3 Protein | +Inquiry |
ANK3-5633H | Recombinant Human ANK3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANK3 Products
Required fields are marked with *
My Review for All ANK3 Products
Required fields are marked with *