Recombinant Human ANKRD10 protein, His-tagged
Cat.No. : | ANKRD10-9664H |
Product Overview : | Recombinant Human ANKRD10 protein(1-151 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-151 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLECISALVANGAHV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
MIM-Weblink : |
Gene Name | ANKRD10 ankyrin repeat domain 10 [ Homo sapiens ] |
Official Symbol | ANKRD10 |
Synonyms | Ankrd10; Ankyrin repeat domain-containing protein 10; ANR10_HUMAN; RP11-120J20.3; ANKRD10 |
mRNA Refseq | NM_017664.2 |
Protein Refseq | NP_060134.2 |
UniProt ID | Q9NXR5 |
Gene ID | 55608 |
◆ Recombinant Proteins | ||
ANKRD10-571H | Recombinant Human ANKRD10 protein, GST-tagged | +Inquiry |
ANKRD10-157R | Recombinant Rhesus Macaque ANKRD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD10-2512C | Recombinant Chicken ANKRD10 | +Inquiry |
ANKRD10-738H | Recombinant Human ANKRD10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD10-329R | Recombinant Rhesus monkey ANKRD10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD10-8857HCL | Recombinant Human ANKRD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD10 Products
Required fields are marked with *
My Review for All ANKRD10 Products
Required fields are marked with *
0
Inquiry Basket