Recombinant Human ANKRD13A protein, GST-tagged
| Cat.No. : | ANKRD13A-301183H |
| Product Overview : | Recombinant Human ANKRD13A (499-590 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ser499-Lys590 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ANKRD13A ankyrin repeat domain 13A [ Homo sapiens ] |
| Official Symbol | ANKRD13A |
| Synonyms | ANKRD13A; ankyrin repeat domain 13A; ANKRD13, ankyrin repeat domain 13; ankyrin repeat domain-containing protein 13A; NY REN 25; NY-REN-25 antigen; ANKRD13; NY-REN-25; |
| Gene ID | 88455 |
| mRNA Refseq | NM_033121 |
| Protein Refseq | NP_149112 |
| UniProt ID | Q8IZ07 |
| ◆ Recombinant Proteins | ||
| ANKRD13A-6710Z | Recombinant Zebrafish ANKRD13A | +Inquiry |
| ANKRD13A-301183H | Recombinant Human ANKRD13A protein, GST-tagged | +Inquiry |
| ANKRD13A-1653M | Recombinant Mouse ANKRD13A Protein | +Inquiry |
| ANKRD13A-2544H | Recombinant Human ANKRD13A protein, His-tagged | +Inquiry |
| ANKRD13A-538M | Recombinant Mouse ANKRD13A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD13A Products
Required fields are marked with *
My Review for All ANKRD13A Products
Required fields are marked with *




