Recombinant Human ANKRD13A protein, His-tagged
Cat.No. : | ANKRD13A-2544H |
Product Overview : | Recombinant Human ANKRD13A protein(499-590 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 499-590 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ANKRD13A ankyrin repeat domain 13A [ Homo sapiens ] |
Official Symbol | ANKRD13A |
Synonyms | ANKRD13A; ankyrin repeat domain 13A; ANKRD13, ankyrin repeat domain 13; ankyrin repeat domain-containing protein 13A; NY REN 25; NY-REN-25 antigen; ANKRD13; NY-REN-25; |
Gene ID | 88455 |
mRNA Refseq | NM_033121 |
Protein Refseq | NP_149112 |
UniProt ID | Q8IZ07 |
◆ Recombinant Proteins | ||
ANKRD13A-2544H | Recombinant Human ANKRD13A protein, His-tagged | +Inquiry |
ANKRD13A-1653M | Recombinant Mouse ANKRD13A Protein | +Inquiry |
ANKRD13A-538M | Recombinant Mouse ANKRD13A Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD13A-301183H | Recombinant Human ANKRD13A protein, GST-tagged | +Inquiry |
ANKRD13A-1494HF | Recombinant Full Length Human ANKRD13A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD13A Products
Required fields are marked with *
My Review for All ANKRD13A Products
Required fields are marked with *
0
Inquiry Basket