Recombinant Human ANKRD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ANKRD2-5117H |
| Product Overview : | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 36 kDa |
| AA Sequence : | MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ANKRD2 ankyrin repeat domain 2 [ Homo sapiens (human) ] |
| Official Symbol | ANKRD2 |
| Synonyms | ANKRD2; ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; ARPP; hArpp; ankyrin-repeat protein; skeletal muscle ankyrin repeat protein; MGC104314; |
| Gene ID | 26287 |
| mRNA Refseq | NM_001129981 |
| Protein Refseq | NP_001123453 |
| MIM | 610734 |
| UniProt ID | Q9GZV1 |
| ◆ Recombinant Proteins | ||
| ANKRD2-5192H | Recombinant Human ANKRD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Ankrd2-1632M | Recombinant Mouse Ankrd2 Protein, Myc/DDK-tagged | +Inquiry |
| ANKRD2-5117H | Recombinant Human ANKRD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ANKRD2-1199HF | Recombinant Full Length Human ANKRD2 Protein, GST-tagged | +Inquiry |
| ANKRD2-2072H | Recombinant Human ANKRD2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANKRD2-8855HCL | Recombinant Human ANKRD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD2 Products
Required fields are marked with *
My Review for All ANKRD2 Products
Required fields are marked with *
