Recombinant Human ANKRD2 protein, GST-tagged
Cat.No. : | ANKRD2-580H |
Product Overview : | Human ANKRD2 full-length ORF (BAG37301.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 63.03 kDa |
AA Sequence : | MDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDTRQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD2 ankyrin repeat domain 2 (stretch responsive muscle) [ Homo sapiens ] |
Official Symbol | ANKRD2 |
Synonyms | ANKRD2; ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; ARPP; hArpp; ankyrin-repeat protein; skeletal muscle ankyrin repeat protein; MGC104314; |
Gene ID | 26287 |
mRNA Refseq | NM_001129981 |
Protein Refseq | NP_001123453 |
MIM | 610734 |
UniProt ID | Q9GZV1 |
◆ Recombinant Proteins | ||
ANKRD2-1199HF | Recombinant Full Length Human ANKRD2 Protein, GST-tagged | +Inquiry |
ANKRD2-580H | Recombinant Human ANKRD2 protein, GST-tagged | +Inquiry |
ANKRD2-2072H | Recombinant Human ANKRD2 Protein, His-tagged | +Inquiry |
ANKRD2-9667H | Recombinant Human ANKRD2, GST-tagged | +Inquiry |
Ankrd2-1632M | Recombinant Mouse Ankrd2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD2-8855HCL | Recombinant Human ANKRD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD2 Products
Required fields are marked with *
My Review for All ANKRD2 Products
Required fields are marked with *
0
Inquiry Basket