Recombinant Human ANKRD2 protein, GST-tagged

Cat.No. : ANKRD2-580H
Product Overview : Human ANKRD2 full-length ORF (BAG37301.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
Molecular Mass : 63.03 kDa
AA Sequence : MDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDTRQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD2 ankyrin repeat domain 2 (stretch responsive muscle) [ Homo sapiens ]
Official Symbol ANKRD2
Synonyms ANKRD2; ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; ARPP; hArpp; ankyrin-repeat protein; skeletal muscle ankyrin repeat protein; MGC104314;
Gene ID 26287
mRNA Refseq NM_001129981
Protein Refseq NP_001123453
MIM 610734
UniProt ID Q9GZV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD2 Products

Required fields are marked with *

My Review for All ANKRD2 Products

Required fields are marked with *

0
cart-icon