Recombinant Human ANKRD37 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ANKRD37-6471H
Product Overview : ANKRD37 MS Standard C13 and N15-labeled recombinant protein (NP_859077) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. Diseases associated with ANKRD37 include Donnai-Barrow Syndrome. An important paralog of this gene is ANKRD42.
Molecular Mass : 16.9 kDa
AA Sequence : MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ANKRD37 ankyrin repeat domain 37 [ Homo sapiens (human) ]
Official Symbol ANKRD37
Synonyms ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507;
Gene ID 353322
mRNA Refseq NM_181726
Protein Refseq NP_859077
MIM 619021
UniProt ID Q7Z713

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD37 Products

Required fields are marked with *

My Review for All ANKRD37 Products

Required fields are marked with *

0
cart-icon
0
compare icon