Recombinant Human ANKRD37 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ANKRD37-6471H
• Product Overview: ANKRD37 MS Standard C13 and N15-labeled recombinant protein (NP_859077) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. Diseases associated with ANKRD37 include Donnai-Barrow Syndrome. An important paralog of this gene is ANKRD42.
• Molecular Mass: 16.9 kDa
• AA Sequence: MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ANKRD37 ankyrin repeat domain 37 [ Homo sapiens (human) ]
• Official Symbol: ANKRD37
• Synonyms: ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507
• Gene ID: 353322
• mRNA Refseq: NM_181726
• Protein Refseq: NP_859077
• MIM: 619021
• UniProt ID: Q7Z713