Recombinant Human ANKRD54 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ANKRD54-1439H |
Product Overview : | ANKRD54 MS Standard C13 and N15-labeled recombinant protein (NP_620152) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ANKRD54 (Ankyrin Repeat Domain 54) is a Protein Coding gene. Diseases associated with ANKRD54 include Neurotic Excoriation and Factitious Disorder. Gene Ontology (GO) annotations related to this gene include protein kinase regulator activity. An important paralog of this gene is ANKRD61. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ANKRD54 ankyrin repeat domain 54 [ Homo sapiens (human) ] |
Official Symbol | ANKRD54 |
Synonyms | ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; LIAR; |
Gene ID | 129138 |
mRNA Refseq | NM_138797 |
Protein Refseq | NP_620152 |
MIM | 613383 |
UniProt ID | Q6NXT1 |
◆ Recombinant Proteins | ||
ANKRD54-333R | Recombinant Rat ANKRD54 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD54-1344HF | Recombinant Full Length Human ANKRD54 Protein, GST-tagged | +Inquiry |
ANKRD54-30143H | Recombinant Human ANKRD54 protein, GST-tagged | +Inquiry |
ANKRD54-605H | Recombinant Human ANKRD54 protein, GST-tagged | +Inquiry |
ANKRD54-7611H | Recombinant Human ANKRD54, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD54 Products
Required fields are marked with *
My Review for All ANKRD54 Products
Required fields are marked with *
0
Inquiry Basket