Recombinant Human ANKRD54 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ANKRD54-1439H
Product Overview : ANKRD54 MS Standard C13 and N15-labeled recombinant protein (NP_620152) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ANKRD54 (Ankyrin Repeat Domain 54) is a Protein Coding gene. Diseases associated with ANKRD54 include Neurotic Excoriation and Factitious Disorder. Gene Ontology (GO) annotations related to this gene include protein kinase regulator activity. An important paralog of this gene is ANKRD61.
Molecular Mass : 32.5 kDa
AA Sequence : MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ANKRD54 ankyrin repeat domain 54 [ Homo sapiens (human) ]
Official Symbol ANKRD54
Synonyms ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; LIAR;
Gene ID 129138
mRNA Refseq NM_138797
Protein Refseq NP_620152
MIM 613383
UniProt ID Q6NXT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD54 Products

Required fields are marked with *

My Review for All ANKRD54 Products

Required fields are marked with *

0
cart-icon
0
compare icon