Recombinant Human ANKS1 protein, GST-tagged
Cat.No. : | ANKS1-610H |
Product Overview : | Human ANKS1 partial ORF ( NP_056060, 1037 a.a. - 1132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKS1A (Ankyrin Repeat And Sterile Alpha Motif Domain Containing 1A) is a Protein Coding gene. Diseases associated with ANKS1A include Adjustment Disorder. An important paralog of this gene is ANKS1B. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | HVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAEMIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKS1A ankyrin repeat and sterile alpha motif domain containing 1A [ Homo sapiens ] |
Official Symbol | ANKS1A |
Synonyms | ANKS1A; ankyrin repeat and sterile alpha motif domain containing 1A; ANKS1, ankyrin repeat and SAM domain containing 1 , ankyrin repeat and sterile alpha motif domain containing 1; ankyrin repeat and SAM domain-containing protein 1A; KIAA0229; Odin; ankyrin repeat and SAM domain containing 1; ANKS1; MGC42354; |
Gene ID | 23294 |
mRNA Refseq | NM_015245 |
Protein Refseq | NP_056060 |
MIM | 608994 |
UniProt ID | Q92625 |
◆ Recombinant Proteins | ||
ANKS1A-9677H | Recombinant Human ANKS1A, GST-tagged | +Inquiry |
ANKS1A-1203HF | Recombinant Full Length Human ANKS1A Protein, GST-tagged | +Inquiry |
ANKS1A-611H | Recombinant Human ANKS1A protein, GST-tagged | +Inquiry |
ANKS1-610H | Recombinant Human ANKS1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKS1A-83HCL | Recombinant Human ANKS1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKS1A Products
Required fields are marked with *
My Review for All ANKS1A Products
Required fields are marked with *
0
Inquiry Basket