Recombinant Human ANKS1 protein, GST-tagged

Cat.No. : ANKS1-610H
Product Overview : Human ANKS1 partial ORF ( NP_056060, 1037 a.a. - 1132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKS1A (Ankyrin Repeat And Sterile Alpha Motif Domain Containing 1A) is a Protein Coding gene. Diseases associated with ANKS1A include Adjustment Disorder. An important paralog of this gene is ANKS1B.
Molecular Mass : 36.3 kDa
AA Sequence : HVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAEMIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKS1A ankyrin repeat and sterile alpha motif domain containing 1A [ Homo sapiens ]
Official Symbol ANKS1A
Synonyms ANKS1A; ankyrin repeat and sterile alpha motif domain containing 1A; ANKS1, ankyrin repeat and SAM domain containing 1 , ankyrin repeat and sterile alpha motif domain containing 1; ankyrin repeat and SAM domain-containing protein 1A; KIAA0229; Odin; ankyrin repeat and SAM domain containing 1; ANKS1; MGC42354;
Gene ID 23294
mRNA Refseq NM_015245
Protein Refseq NP_056060
MIM 608994
UniProt ID Q92625

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKS1A Products

Required fields are marked with *

My Review for All ANKS1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon