Recombinant Human ANKS1B protein, His-tagged
| Cat.No. : | ANKS1B-3767H |
| Product Overview : | Recombinant Human ANKS1B protein(446-510 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 446-510 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ANKS1B ankyrin repeat and sterile alpha motif domain containing 1B [ Homo sapiens ] |
| Official Symbol | ANKS1B |
| Synonyms | ANKS1B; ankyrin repeat and sterile alpha motif domain containing 1B; ankyrin repeat and sterile alpha motif domain-containing protein 1B; AIDA 1; ANKS2; cajalin 2; EB 1; E2a-Pbx1-associated protein; amyloid-beta precursor protein intracellular domain associated protein 1; EB1; AIDA; EB-1; AIDA-1; cajalin-2; MGC26087; |
| Gene ID | 56899 |
| mRNA Refseq | NM_001204065 |
| Protein Refseq | NP_001190994 |
| MIM | 607815 |
| UniProt ID | Q7Z6G8 |
| ◆ Recombinant Proteins | ||
| Anks1b-1640M | Recombinant Mouse Anks1b Protein, Myc/DDK-tagged | +Inquiry |
| ANKS1B-3767H | Recombinant Human ANKS1B protein, His-tagged | +Inquiry |
| ANKS1B-5822Z | Recombinant Zebrafish ANKS1B | +Inquiry |
| Anks1b-3474R | Recombinant Rat Anks1b, His-tagged | +Inquiry |
| ANKS1B-2164H | Recombinant Human ANKS1B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKS1B Products
Required fields are marked with *
My Review for All ANKS1B Products
Required fields are marked with *
