Recombinant Human ANKS1B protein, His-tagged

Cat.No. : ANKS1B-3767H
Product Overview : Recombinant Human ANKS1B protein(446-510 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability July 14, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 446-510 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name ANKS1B ankyrin repeat and sterile alpha motif domain containing 1B [ Homo sapiens ]
Official Symbol ANKS1B
Synonyms ANKS1B; ankyrin repeat and sterile alpha motif domain containing 1B; ankyrin repeat and sterile alpha motif domain-containing protein 1B; AIDA 1; ANKS2; cajalin 2; EB 1; E2a-Pbx1-associated protein; amyloid-beta precursor protein intracellular domain associated protein 1; EB1; AIDA; EB-1; AIDA-1; cajalin-2; MGC26087;
Gene ID 56899
mRNA Refseq NM_001204065
Protein Refseq NP_001190994
MIM 607815
UniProt ID Q7Z6G8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKS1B Products

Required fields are marked with *

My Review for All ANKS1B Products

Required fields are marked with *

0
cart-icon
0
compare icon