Recombinant Human ANKS1B protein, His-tagged
Cat.No. : | ANKS1B-3767H |
Product Overview : | Recombinant Human ANKS1B protein(446-510 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 446-510 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ANKS1B ankyrin repeat and sterile alpha motif domain containing 1B [ Homo sapiens ] |
Official Symbol | ANKS1B |
Synonyms | ANKS1B; ankyrin repeat and sterile alpha motif domain containing 1B; ankyrin repeat and sterile alpha motif domain-containing protein 1B; AIDA 1; ANKS2; cajalin 2; EB 1; E2a-Pbx1-associated protein; amyloid-beta precursor protein intracellular domain associated protein 1; EB1; AIDA; EB-1; AIDA-1; cajalin-2; MGC26087; |
Gene ID | 56899 |
mRNA Refseq | NM_001204065 |
Protein Refseq | NP_001190994 |
MIM | 607815 |
UniProt ID | Q7Z6G8 |
◆ Recombinant Proteins | ||
ANKS1B-3934HF | Recombinant Full Length Human ANKS1B Protein, GST-tagged | +Inquiry |
ANKS1B-5822Z | Recombinant Zebrafish ANKS1B | +Inquiry |
ANKS1B-3767H | Recombinant Human ANKS1B protein, His-tagged | +Inquiry |
Anks1b-1640M | Recombinant Mouse Anks1b Protein, Myc/DDK-tagged | +Inquiry |
ANKS1B-9678H | Recombinant Human ANKS1B, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKS1B Products
Required fields are marked with *
My Review for All ANKS1B Products
Required fields are marked with *