Recombinant Human ANP32A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ANP32A-5466H |
| Product Overview : | ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ANP32A (Acidic Nuclear Phosphoprotein 32 Family Member A) is a Protein Coding gene. Diseases associated with ANP32A include Spinocerebellar Ataxia 1 and Primary Cerebellar Degeneration. Among its related pathways are Granzyme-A Pathway and Granzyme Pathway. An important paralog of this gene is ANP32B. |
| Molecular Mass : | 28.6 kDa |
| AA Sequence : | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ANP32A acidic nuclear phosphoprotein 32 family member A [ Homo sapiens (human) ] |
| Official Symbol | ANP32A |
| Synonyms | ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; hepatopoietin Cn; acidic nuclear phosphoprotein pp32; leucine-rich acidic nuclear protein; putative HLA-DR-associated protein I; inhibitor-1 of protein phosphatase-2A; cerebellar leucine rich acidic nuclear protein; putative human HLA class II associated protein I; potent heat-stable protein phosphatase 2A inhibitor I1PP2A; HPPCn; PHAP1; MGC119787; MGC150373; |
| Gene ID | 8125 |
| mRNA Refseq | NM_006305 |
| Protein Refseq | NP_006296 |
| MIM | 600832 |
| UniProt ID | P39687 |
| ◆ Recombinant Proteins | ||
| Anp32a-1697M | Recombinant Mouse Anp32a protein, His & GST-tagged | +Inquiry |
| ANP32A-5466H | Recombinant Human ANP32A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ANP32A-2803H | Recombinant Human ANP32A, His-tagged | +Inquiry |
| ANP32A-1064HF | Recombinant Full Length Human ANP32A Protein, GST-tagged | +Inquiry |
| ANP32A-617H | Recombinant Human ANP32A protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANP32A-8843HCL | Recombinant Human ANP32A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANP32A Products
Required fields are marked with *
My Review for All ANP32A Products
Required fields are marked with *
