Recombinant Human ANPEP protein(151-230 aa), C-His-tagged

• Cat.No.: ANPEP-2657H
• Product Overview: Recombinant Human ANPEP protein(P15144)(151-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMK

Gene Information

• Gene Name: ANPEP alanyl (membrane) aminopeptidase [ Homo sapiens ]
• Official Symbol: ANPEP
• Synonyms: ANPEP; alanyl (membrane) aminopeptidase; CD13, PEPN; aminopeptidase N; aminopeptidase M; gp150; LAP1; microsomal aminopeptidase; p150; AP-M; AP-N; hAPN; alanyl aminopeptidase; myeloid plasma membrane glycoprotein CD13; APN; CD13; P150; PEPN; GP150
• Gene ID: 290
• mRNA Refseq: NM_001150
• Protein Refseq: NP_001141
• MIM: 151530
• UniProt ID: P15144