Recombinant Human ANPEP protein(151-230 aa), C-His-tagged
Cat.No. : | ANPEP-2657H |
Product Overview : | Recombinant Human ANPEP protein(P15144)(151-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 151-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMK |
Gene Name | ANPEP alanyl (membrane) aminopeptidase [ Homo sapiens ] |
Official Symbol | ANPEP |
Synonyms | ANPEP; alanyl (membrane) aminopeptidase; CD13, PEPN; aminopeptidase N; aminopeptidase M; gp150; LAP1; microsomal aminopeptidase; p150; AP-M; AP-N; hAPN; alanyl aminopeptidase; myeloid plasma membrane glycoprotein CD13; APN; CD13; P150; PEPN; GP150; |
Gene ID | 290 |
mRNA Refseq | NM_001150 |
Protein Refseq | NP_001141 |
MIM | 151530 |
UniProt ID | P15144 |
◆ Recombinant Proteins | ||
ANPEP-694H | Active Recombinant Human ANPEP Protein, His-tagged | +Inquiry |
ANPEP-341H | Recombinant Human ANPEP Protein, His (Fc)-Avi-tagged | +Inquiry |
Anpep-2514R | Recombinant Rat Anpep protein, His-SUMO-tagged | +Inquiry |
ANPEP-1417H | Recombinant Human ANPEP protein, His-GST & Myc-tagged | +Inquiry |
ANPEP-1037HF | Recombinant Full Length Human ANPEP Protein | +Inquiry |
◆ Native Proteins | ||
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANPEP-3090HCL | Recombinant Human ANPEP cell lysate | +Inquiry |
ANPEP-3000MCL | Recombinant Mouse ANPEP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANPEP Products
Required fields are marked with *
My Review for All ANPEP Products
Required fields are marked with *
0
Inquiry Basket