Recombinant Full Length Human ANPEP Protein, C-Flag-tagged
Cat.No. : | ANPEP-794HFL |
Product Overview : | Recombinant Full Length Human ANPEP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 106.3 kDa |
AA Sequence : | MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKA WNRYRLPNTLKPDSYQVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLR GVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATT QMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLL AFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFN AGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSF LSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGT LSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYWLIDVRAQNDLFSTSGNEWVLLNLNVTGYY RVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS SLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEE MVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFS TEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane |
Protein Pathways : | Glutathione metabolism, Hematopoietic cell lineage, Metabolic pathways, Renin-angiotensin system |
Full Length : | Full L. |
Gene Name | ANPEP alanyl aminopeptidase, membrane [ Homo sapiens (human) ] |
Official Symbol | ANPEP |
Synonyms | APN; AP-M; AP-N; CD13; LAP1; P150; PEPN; hAPN; GP150 |
Gene ID | 290 |
mRNA Refseq | NM_001150.3 |
Protein Refseq | NP_001141.2 |
MIM | 151530 |
UniProt ID | P15144 |
◆ Recombinant Proteins | ||
ANPEP-1417H | Recombinant Human ANPEP protein, His-GST & Myc-tagged | +Inquiry |
ANPEP-794HFL | Recombinant Full Length Human ANPEP Protein, C-Flag-tagged | +Inquiry |
ANPEP-6424C | Recombinant Chicken ANPEP | +Inquiry |
ANPEP-247H | Recombinant Human ANPEP(Lys69-Lys967) Protein, C-6*His-tagged | +Inquiry |
Anpep-905M | Recombinant Mouse Anpep protein(Lys66-Ser966), His-tagged | +Inquiry |
◆ Native Proteins | ||
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANPEP-3090HCL | Recombinant Human ANPEP cell lysate | +Inquiry |
ANPEP-3000MCL | Recombinant Mouse ANPEP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANPEP Products
Required fields are marked with *
My Review for All ANPEP Products
Required fields are marked with *
0
Inquiry Basket