Recombinant Human ANXA2R protein, GST-tagged

Cat.No. : ANXA2R-632H
Product Overview : Human ANXA2R full-length ORF ( NP_001014301.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANXA2R (Annexin A2 Receptor) is a Protein Coding gene.
Molecular Mass : 48.1 kDa
AA Sequence : MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANXA2R annexin A2 receptor [ Homo sapiens (human) ]
Official Symbol ANXA2R
Synonyms ANXA2R; annexin A2 receptor; AX2R; AXIIR; C5orf39; annexin-2 receptor; annexin II receptor
Gene ID 389289
mRNA Refseq NM_001014279
Protein Refseq NP_001014301
MIM 611296
UniProt ID Q3ZCQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANXA2R Products

Required fields are marked with *

My Review for All ANXA2R Products

Required fields are marked with *

0
cart-icon