Recombinant Human ANXA2R protein, GST-tagged
| Cat.No. : | ANXA2R-632H |
| Product Overview : | Human ANXA2R full-length ORF ( NP_001014301.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANXA2R (Annexin A2 Receptor) is a Protein Coding gene. |
| Molecular Mass : | 48.1 kDa |
| AA Sequence : | MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANXA2R annexin A2 receptor [ Homo sapiens (human) ] |
| Official Symbol | ANXA2R |
| Synonyms | ANXA2R; annexin A2 receptor; AX2R; AXIIR; C5orf39; annexin-2 receptor; annexin II receptor |
| Gene ID | 389289 |
| mRNA Refseq | NM_001014279 |
| Protein Refseq | NP_001014301 |
| MIM | 611296 |
| UniProt ID | Q3ZCQ2 |
| ◆ Recombinant Proteins | ||
| ANXA2R-380H | Recombinant Human ANXA2R Protein, GST-His-tagged | +Inquiry |
| ANXA2R-1315HF | Recombinant Full Length Human ANXA2R Protein, GST-tagged | +Inquiry |
| ANXA2R-632H | Recombinant Human ANXA2R protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA2R-8010HCL | Recombinant Human C5orf39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA2R Products
Required fields are marked with *
My Review for All ANXA2R Products
Required fields are marked with *



