Recombinant Human ANXA5 protein(11-200 aa), C-His-tagged
Cat.No. : | ANXA5-2606H |
Product Overview : | Recombinant Human ANXA5 protein(P08758)(11-200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-200 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 22.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGT |
Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
Official Symbol | ANXA5 |
Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2; |
Gene ID | 308 |
mRNA Refseq | NM_001154 |
Protein Refseq | NP_001145 |
MIM | 131230 |
UniProt ID | P08758 |
◆ Recombinant Proteins | ||
ANXA5-2625H | Recombinant Human Annexin A5, FITC | +Inquiry |
ANXA5-170H | Recombinant Human ANXA5 Protein, His-tagged | +Inquiry |
Anxa5-3497R | Recombinant Rat Anxa5, His-tagged | +Inquiry |
ANXA5-019H | Recombinant Hamster Annexin A5 Protein, His tagged | +Inquiry |
ANXA5-2623H | Recombinant Human Annexin A5, APC | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket