Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged
Cat.No. : | ANXA9-2487H |
Product Overview : | Recombinant Human ANXA9 protein(O76027)(121-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 121-210 aa |
Form : | 0.15 M Phosphate buffered saline |
AASequence : | ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ANXA9 annexin A9 [ Homo sapiens ] |
Official Symbol | ANXA9 |
Synonyms | ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI; |
Gene ID | 8416 |
mRNA Refseq | NM_003568 |
Protein Refseq | NP_003559 |
MIM | 603319 |
UniProt ID | O76027 |
◆ Recombinant Proteins | ||
HAS2-3351H | Recombinant Human HAS2 Protein (Glu67-Thr172), His tagged | +Inquiry |
VMN1R45-18175M | Recombinant Mouse VMN1R45 Protein | +Inquiry |
NTRK3-160HAF647 | Active Recombinant Human NTRK3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
WIPF1-3731H | Recombinant Human WIPF1, His-tagged | +Inquiry |
NRG1-141H | Active Recombinant Human NRG1 Protein (Ser177-Glu241), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
CTSG-26490TH | Native Human CTSG | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABYR-7905HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
Fetal Trachea-178H | Human Fetal Trachea Lysate | +Inquiry |
SLAMF1-1004RCL | Recombinant Rat SLAMF1 cell lysate | +Inquiry |
PDE6G-3344HCL | Recombinant Human PDE6G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA9 Products
Required fields are marked with *
My Review for All ANXA9 Products
Required fields are marked with *
0
Inquiry Basket