Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged
Cat.No. : | ANXA9-2487H |
Product Overview : | Recombinant Human ANXA9 protein(O76027)(121-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-210 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE |
Gene Name | ANXA9 annexin A9 [ Homo sapiens ] |
Official Symbol | ANXA9 |
Synonyms | ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI; |
Gene ID | 8416 |
mRNA Refseq | NM_003568 |
Protein Refseq | NP_003559 |
MIM | 603319 |
UniProt ID | O76027 |
◆ Recombinant Proteins | ||
ANXA9-588M | Recombinant Mouse ANXA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANXA9-0254H | Recombinant Human ANXA9 Protein (Met8-Met345), N-GST-tagged | +Inquiry |
ANXA9-639H | Recombinant Human ANXA9 protein, GST-tagged | +Inquiry |
ANXA9-2487H | Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged | +Inquiry |
ANXA9-2522H | Recombinant Human ANXA9 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA9-8825HCL | Recombinant Human ANXA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA9 Products
Required fields are marked with *
My Review for All ANXA9 Products
Required fields are marked with *
0
Inquiry Basket