Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged
| Cat.No. : | ANXA9-2487H | 
| Product Overview : | Recombinant Human ANXA9 protein(O76027)(121-210 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 121-210 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C.  | 
                                
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE | 
| Gene Name | ANXA9 annexin A9 [ Homo sapiens ] | 
| Official Symbol | ANXA9 | 
| Synonyms | ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI; | 
| Gene ID | 8416 | 
| mRNA Refseq | NM_003568 | 
| Protein Refseq | NP_003559 | 
| MIM | 603319 | 
| UniProt ID | O76027 | 
| ◆ Recombinant Proteins | ||
| ANXA9-2522H | Recombinant Human ANXA9 protein, His-SUMO-tagged | +Inquiry | 
| ANXA9-588M | Recombinant Mouse ANXA9 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ANXA9-5262H | Recombinant Human ANXA9 protein, His/GST-tagged | +Inquiry | 
| ANXA9-2487H | Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged | +Inquiry | 
| Anxa9-1650M | Recombinant Mouse Anxa9 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ANXA9-8825HCL | Recombinant Human ANXA9 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ANXA9 Products
Required fields are marked with *
My Review for All ANXA9 Products
Required fields are marked with *
  
        
    
      
            