Recombinant Human ANXA9 protein(121-210 aa), C-His-tagged

Cat.No. : ANXA9-2487H
Product Overview : Recombinant Human ANXA9 protein(O76027)(121-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
ProteinLength : 121-210 aa
Form : 0.15 M Phosphate buffered saline
AASequence : ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name ANXA9 annexin A9 [ Homo sapiens ]
Official Symbol ANXA9
Synonyms ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI;
Gene ID 8416
mRNA Refseq NM_003568
Protein Refseq NP_003559
MIM 603319
UniProt ID O76027

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANXA9 Products

Required fields are marked with *

My Review for All ANXA9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon