Recombinant Human AP1S2 protein, GST-tagged

Cat.No. : AP1S2-7844H
Product Overview : Recombinant Human AP1S2 protein(1-157 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-157 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name AP1S2 adaptor-related protein complex 1, sigma 2 subunit [ Homo sapiens ]
Official Symbol AP1S2
Synonyms AP1S2; adaptor-related protein complex 1, sigma 2 subunit; mental retardation, X linked 59 , MRX59; AP-1 complex subunit sigma-2; SIGMA1B; sigma1B-adaptin; sigma-adaptin 1B; sigma 1B subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1B subunit; clathrin adaptor complex AP1 sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma-1B subunit; adapter-related protein complex 1 sigma-1B subunit; clathrin assembly protein complex 1 sigma-1B small chain; DC22; MRX59; MRXSF; MRXS21; MGC:1902;
Gene ID 8905
mRNA Refseq NM_003916
Protein Refseq NP_003907
MIM 300629
UniProt ID P56377

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1S2 Products

Required fields are marked with *

My Review for All AP1S2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon