Recombinant Human AP1S2 protein, GST-tagged
Cat.No. : | AP1S2-7844H |
Product Overview : | Recombinant Human AP1S2 protein(1-157 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-157 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | AP1S2 adaptor-related protein complex 1, sigma 2 subunit [ Homo sapiens ] |
Official Symbol | AP1S2 |
Synonyms | AP1S2; adaptor-related protein complex 1, sigma 2 subunit; mental retardation, X linked 59 , MRX59; AP-1 complex subunit sigma-2; SIGMA1B; sigma1B-adaptin; sigma-adaptin 1B; sigma 1B subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1B subunit; clathrin adaptor complex AP1 sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma-1B subunit; adapter-related protein complex 1 sigma-1B subunit; clathrin assembly protein complex 1 sigma-1B small chain; DC22; MRX59; MRXSF; MRXS21; MGC:1902; |
Gene ID | 8905 |
mRNA Refseq | NM_003916 |
Protein Refseq | NP_003907 |
MIM | 300629 |
UniProt ID | P56377 |
◆ Recombinant Proteins | ||
AP1S2-1408C | Recombinant Chicken AP1S2 | +Inquiry |
AP1S2-4967H | Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2 Subunit, His-tagged | +Inquiry |
AP1S2-0243H | Recombinant Human AP1S2 Protein (Met1-Thr157), N-His-tagged | +Inquiry |
AP1S2-174R | Recombinant Rhesus Macaque AP1S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP1S2-650H | Recombinant Human AP1S2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP1S2 Products
Required fields are marked with *
My Review for All AP1S2 Products
Required fields are marked with *