Recombinant Human AP1S2 protein, GST-tagged

• Cat.No.: AP1S2-7844H
• Product Overview: Recombinant Human AP1S2 protein(1-157 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-157 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: AP1S2 adaptor-related protein complex 1, sigma 2 subunit [ Homo sapiens ]
• Official Symbol: AP1S2
• Synonyms: AP1S2; adaptor-related protein complex 1, sigma 2 subunit; mental retardation, X linked 59 , MRX59; AP-1 complex subunit sigma-2; SIGMA1B; sigma1B-adaptin; sigma-adaptin 1B; sigma 1B subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1B subunit; clathrin adaptor complex AP1 sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma 1B subunit; golgi adaptor HA1/AP1 adaptin sigma-1B subunit; adapter-related protein complex 1 sigma-1B subunit; clathrin assembly protein complex 1 sigma-1B small chain; DC22; MRX59; MRXSF; MRXS21; MGC:1902
• Gene ID: 8905
• mRNA Refseq: NM_003916
• Protein Refseq: NP_003907
• MIM: 300629
• UniProt ID: P56377