Recombinant Human AP3M1 protein, GST-tagged
Cat.No. : | AP3M1-657H |
Product Overview : | Human AP3M1 full-length ORF ( NP_036227.1, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the medium subunit of AP-3, which is an adaptor-related protein complex associated with the Golgi region as well as more peripheral intracellular structures. AP-3 facilitates the budding of vesicles from the Golgi membrane, and it may directly function in protein sorting to the endosomal/lysosomal system. AP-3 is a heterotetrameric protein complex composed of two large subunits (delta and beta3), a medium subunit (mu3), and a small subunit (sigma 3). Mutations in one of the large subunits of AP-3 have been associated with the Hermansky-Pudlak syndrome, a genetic disorder characterized by defective lysosome-related organelles. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 73.3 kDa |
AA Sequence : | MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP3M1 adaptor-related protein complex 3, mu 1 subunit [ Homo sapiens ] |
Official Symbol | AP3M1 |
Synonyms | AP3M1; adaptor-related protein complex 3, mu 1 subunit; AP-3 complex subunit mu-1; mu3A-adaptin; mu-adaptin 3A; AP-3 adapter complex mu3A subunit; clathrin adaptor complex AP3, mu-3A subunit; adapter-related protein complex 3 mu-1 subunit; MGC22164; |
Gene ID | 26985 |
mRNA Refseq | NM_012095 |
Protein Refseq | NP_036227 |
MIM | 610366 |
UniProt ID | Q9Y2T2 |
◆ Recombinant Proteins | ||
AP3M1-2889C | Recombinant Chicken AP3M1 | +Inquiry |
AP3M1-606M | Recombinant Mouse AP3M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ap3m1-3541R | Recombinant Rat Ap3m1, His-tagged | +Inquiry |
AP3M1-657H | Recombinant Human AP3M1 protein, GST-tagged | +Inquiry |
AP3M1-11440Z | Recombinant Zebrafish AP3M1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP3M1 Products
Required fields are marked with *
My Review for All AP3M1 Products
Required fields are marked with *
0
Inquiry Basket