Expand| Cat.No. : | AP3M1-657H |
| Product Overview : | Human AP3M1 full-length ORF ( NP_036227.1, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description : | The protein encoded by this gene is the medium subunit of AP-3, which is an adaptor-related protein complex associated with the Golgi region as well as more peripheral intracellular structures. AP-3 facilitates the budding of vesicles from the Golgi membrane, and it may directly function in protein sorting to the endosomal/lysosomal system. AP-3 is a heterotetrameric protein complex composed of two large subunits (delta and beta3), a medium subunit (mu3), and a small subunit (sigma 3). Mutations in one of the large subunits of AP-3 have been associated with the Hermansky-Pudlak syndrome, a genetic disorder characterized by defective lysosome-related organelles. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 73.3 kDa |
| AA Sequence : | MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Figure : |
12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gene Name : | AP3M1 adaptor-related protein complex 3, mu 1 subunit [ Homo sapiens ] |
| Official Symbol : | AP3M1 |
| Synonyms : | AP3M1; adaptor-related protein complex 3, mu 1 subunit; AP-3 complex subunit mu-1; mu3A-adaptin; mu-adaptin 3A; AP-3 adapter complex mu3A subunit; clathrin adaptor complex AP3, mu-3A subunit; adapter-related protein complex 3 mu-1 subunit; MGC22164; |
| Gene ID : | 26985 |
| mRNA Refseq : | NM_012095 |
| Protein Refseq : | NP_036227 |
| MIM : | 610366 |
| UniProt ID : | Q9Y2T2 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All AP3M1 Products
Download Datasheet