Recombinant Human APBA2 protein, GST-tagged
| Cat.No. : | APBA2-667H |
| Product Overview : | Human APBA2 full-length ORF (BAC85951.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 53.24 kDa |
| AA Sequence : | MAVIPESAWKHPDYVDDGLSGVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDVSKPLPGHSPPKVHSPGRLQDPGAVETTLRWKASMLLLMFPVDQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APBA2 amyloid beta (A4) precursor protein-binding, family A, member 2 [ Homo sapiens ] |
| Official Symbol | APBA2 |
| Synonyms | APBA2; amyloid beta (A4) precursor protein-binding, family A, member 2; amyloid beta (A4) precursor protein binding, family A, member 2 (X11 like) , MINT2, X11 like , X11L; amyloid beta A4 precursor protein-binding family A member 2; D15S1518E; HsT16821; LIN 10; MGC:14091; mint-2; X11-like protein; adapter protein X11beta; neuron-specific X11L protein; neuronal munc18-1-interacting protein 2; phosphotyrosine-binding/-interacting domain (PTB)-bearing protein; amyloid beta (A4) precursor protein-binding, family A, member 2 (X11-like); X11L; MINT2; LIN-10; X11-BETA; MGC99508; |
| Gene ID | 321 |
| mRNA Refseq | NM_001130414 |
| Protein Refseq | NP_001123886 |
| MIM | 602712 |
| UniProt ID | Q99767 |
| ◆ Recombinant Proteins | ||
| APBA2-9728H | Recombinant Human APBA2, GST-tagged | +Inquiry |
| APBA2-1078HF | Recombinant Full Length Human APBA2 Protein, GST-tagged | +Inquiry |
| APBA2-364R | Recombinant Rat APBA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APBA2-198H | Recombinant Human APBA2 protein, His&Myc-tagged | +Inquiry |
| APBA2-667H | Recombinant Human APBA2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APBA2-8805HCL | Recombinant Human APBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APBA2 Products
Required fields are marked with *
My Review for All APBA2 Products
Required fields are marked with *
