Recombinant Human APBA2 protein, GST-tagged

Cat.No. : APBA2-667H
Product Overview : Human APBA2 full-length ORF (BAC85951.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 53.24 kDa
AA Sequence : MAVIPESAWKHPDYVDDGLSGVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDVSKPLPGHSPPKVHSPGRLQDPGAVETTLRWKASMLLLMFPVDQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APBA2 amyloid beta (A4) precursor protein-binding, family A, member 2 [ Homo sapiens ]
Official Symbol APBA2
Synonyms APBA2; amyloid beta (A4) precursor protein-binding, family A, member 2; amyloid beta (A4) precursor protein binding, family A, member 2 (X11 like) , MINT2, X11 like , X11L; amyloid beta A4 precursor protein-binding family A member 2; D15S1518E; HsT16821; LIN 10; MGC:14091; mint-2; X11-like protein; adapter protein X11beta; neuron-specific X11L protein; neuronal munc18-1-interacting protein 2; phosphotyrosine-binding/-interacting domain (PTB)-bearing protein; amyloid beta (A4) precursor protein-binding, family A, member 2 (X11-like); X11L; MINT2; LIN-10; X11-BETA; MGC99508;
Gene ID 321
mRNA Refseq NM_001130414
Protein Refseq NP_001123886
MIM 602712
UniProt ID Q99767

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APBA2 Products

Required fields are marked with *

My Review for All APBA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon