Recombinant Human APBB2 protein, GST-tagged

Cat.No. : APBB2-670H
Product Overview : Human APBB2 partial ORF ( AAH27946, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Polymorphisms in this gene have been associated with Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Molecular Mass : 36.74 kDa
AA Sequence : MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 [ Homo sapiens ]
Official Symbol APBB2
Synonyms APBB2; amyloid beta (A4) precursor protein-binding, family B, member 2; amyloid beta A4 precursor protein-binding family B member 2; Fe65 like; FE65L; FE65L1; MGC35575; Fe65-like 1; protein Fe65-like 1; DKFZp434E033;
Gene ID 323
mRNA Refseq NM_001166050
Protein Refseq NP_001159522
MIM 602710
UniProt ID Q92870

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APBB2 Products

Required fields are marked with *

My Review for All APBB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon