Recombinant Human APBB2 protein, GST-tagged
| Cat.No. : | APBB2-670H |
| Product Overview : | Human APBB2 partial ORF ( AAH27946, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Polymorphisms in this gene have been associated with Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APBB2 amyloid beta (A4) precursor protein-binding, family B, member 2 [ Homo sapiens ] |
| Official Symbol | APBB2 |
| Synonyms | APBB2; amyloid beta (A4) precursor protein-binding, family B, member 2; amyloid beta A4 precursor protein-binding family B member 2; Fe65 like; FE65L; FE65L1; MGC35575; Fe65-like 1; protein Fe65-like 1; DKFZp434E033; |
| Gene ID | 323 |
| mRNA Refseq | NM_001166050 |
| Protein Refseq | NP_001159522 |
| MIM | 602710 |
| UniProt ID | Q92870 |
| ◆ Recombinant Proteins | ||
| APBB2-8172H | Recombinant Human APBB2 protein, His & GST-tagged | +Inquiry |
| APBB2-670H | Recombinant Human APBB2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APBB2-8802HCL | Recombinant Human APBB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APBB2 Products
Required fields are marked with *
My Review for All APBB2 Products
Required fields are marked with *
