"ATG5" Related Products

Expand
Expand
Expand

Recombinant Human APG5L protein, GST-tagged

Cat.No. : APG5L-679H
Product Overview : Human APG5L partial ORF ( AAH02699, 176 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : ATG5 ATG5 autophagy related 5 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : ATG5
Synonyms : ATG5; ATG5 autophagy related 5 homolog (S. cerevisiae); APG5 (autophagy 5, S. cerevisiae) like , APG5 autophagy 5 like (S. cerevisiae) , APG5L; autophagy protein 5; APG5; ASP; hAPG5; apoptosis specific protein; apoptosis-specific protein; APG5L; APG5-LIKE;
Gene ID : 9474
mRNA Refseq : NM_004849
Protein Refseq : NP_004840
MIM : 604261
UniProt ID : Q9H1Y0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.