Recombinant Human APOA1 protein(31-230 aa), C-His-tagged

• Cat.No.: APOA1-2526H
• Product Overview: Recombinant Human APOA1 protein(P02647)(31-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-230 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 26 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK

Gene Information

• Gene Name: APOA1 apolipoprotein A-I [ Homo sapiens ]
• Official Symbol: APOA1
• Synonyms: APOA1; apolipoprotein A-I; apo-AI; apoA-I; MGC117399
• Gene ID: 335
• mRNA Refseq: NM_000039
• Protein Refseq: NP_000030
• MIM: 107680
• UniProt ID: P02647