Recombinant Human APOA1 protein(31-230 aa), C-His-tagged
Cat.No. : | APOA1-2526H |
Product Overview : | Recombinant Human APOA1 protein(P02647)(31-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 26 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK |
Gene Name | APOA1 apolipoprotein A-I [ Homo sapiens ] |
Official Symbol | APOA1 |
Synonyms | APOA1; apolipoprotein A-I; apo-AI; apoA-I; MGC117399; |
Gene ID | 335 |
mRNA Refseq | NM_000039 |
Protein Refseq | NP_000030 |
MIM | 107680 |
UniProt ID | P02647 |
◆ Recombinant Proteins | ||
Apoa1-7166M | Recombinant Mouse Apoa1 Protein, His-tagged | +Inquiry |
APOA1-699H | Recombinant Human APOA1 protein | +Inquiry |
APOA1-373R | Recombinant Rat APOA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ApoA1-8446R | Active Recombinant Rat ApoA1 | +Inquiry |
Apoa1-6864M | Active Recombinant Mouse Apoa1 protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *