Recombinant Human APOB protein, His-SUMO-tagged
Cat.No. : | APOB-2534H |
Product Overview : | Recombinant Human APOB protein(P04114)(28-127aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 28-127aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.2 |
AA Sequence : | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ] |
Official Symbol | APOB |
Synonyms | APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4; |
Gene ID | 338 |
mRNA Refseq | NM_000384 |
Protein Refseq | NP_000375 |
UniProt ID | P04114 |
◆ Recombinant Proteins | ||
APOB-03P | Recombinant Pan paniscus APOB Protein | +Inquiry |
APOB-2535H | Recombinant Human APOB protein, His-tagged | +Inquiry |
APOB-2095P | Recombinant Pig APOB protein, His & GST-tagged | +Inquiry |
APOB-27149TH | Recombinant Human APOB, His-tagged | +Inquiry |
Apob-494M | Recombinant Mouse Apob Protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-216H | Native Human APOB Protein | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOB Products
Required fields are marked with *
My Review for All APOB Products
Required fields are marked with *
0
Inquiry Basket