Recombinant Pan paniscus APOB Protein

Cat.No. : APOB-03P
Product Overview : Recombinant Pan paniscus APOB Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pan paniscus
Source : E.coli
Description : Apolipoprotein B
Form : Liquid. In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Molecular Mass : ~17.4 kDa
AA Sequence : AEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQ
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.3 mg/ml
Official Full Name : Apolipoprotein B
Gene Name APOB apolipoprotein B [ Pan paniscus (pygmy chimpanzee) ]
Official Symbol APOB
Synonyms FLDB; FCHL2; LDLCQ4; apoB-48; apoB-100
Gene ID 100988651
mRNA Refseq XM_034952688
Protein Refseq XP_034808579
UniProt ID A0A2R8ZD43

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOB Products

Required fields are marked with *

My Review for All APOB Products

Required fields are marked with *

0
cart-icon