Recombinant Pan paniscus APOB Protein
| Cat.No. : | APOB-03P |
| Product Overview : | Recombinant Pan paniscus APOB Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pan paniscus |
| Source : | E.coli |
| Description : | Apolipoprotein B |
| Form : | Liquid. In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0. |
| Molecular Mass : | ~17.4 kDa |
| AA Sequence : | AEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQ |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.3 mg/ml |
| Official Full Name : | Apolipoprotein B |
| Gene Name | APOB apolipoprotein B [ Pan paniscus (pygmy chimpanzee) ] |
| Official Symbol | APOB |
| Synonyms | FLDB; FCHL2; LDLCQ4; apoB-48; apoB-100 |
| Gene ID | 100988651 |
| mRNA Refseq | XM_034952688 |
| Protein Refseq | XP_034808579 |
| UniProt ID | A0A2R8ZD43 |
| ◆ Recombinant Proteins | ||
| APOB-2535H | Recombinant Human APOB protein, His-tagged | +Inquiry |
| Apob-494M | Recombinant Mouse Apob Protein, His-SUMO-tagged | +Inquiry |
| APOB-03P | Recombinant Pan paniscus APOB Protein | +Inquiry |
| APOB-1784M | Recombinant Mouse APOB Protein | +Inquiry |
| APOB-1813H | Recombinant Human APOB Protein (28-127 aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOB-1H | Native Human Apolipoprotein B | +Inquiry |
| APOB-8037H | Native Human Plasma APOB | +Inquiry |
| ApoB-3556H | Native Human ApoB | +Inquiry |
| APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
| APOB-26875TH | Native Human APOB | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOB Products
Required fields are marked with *
My Review for All APOB Products
Required fields are marked with *
