Recombinant Human APOB protein, His-tagged

Cat.No. : APOB-2535H
Product Overview : Recombinant Human APOB protein(P04114)(28-127aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 28-127aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 14.7 kDa
AA Sequence : EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ]
Official Symbol APOB
Synonyms APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4;
Gene ID 338
mRNA Refseq NM_000384
Protein Refseq NP_000375
UniProt ID P04114

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOB Products

Required fields are marked with *

My Review for All APOB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon