Recombinant Human APOB protein, His-tagged
| Cat.No. : | APOB-2535H |
| Product Overview : | Recombinant Human APOB protein(P04114)(28-127aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-127aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.7 kDa |
| AA Sequence : | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ] |
| Official Symbol | APOB |
| Synonyms | APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4; |
| Gene ID | 338 |
| mRNA Refseq | NM_000384 |
| Protein Refseq | NP_000375 |
| UniProt ID | P04114 |
| ◆ Recombinant Proteins | ||
| APOB-2095P | Recombinant Pig APOB protein, His & GST-tagged | +Inquiry |
| Apob-217R | Recombinant Rat Apob Protein, His-tagged | +Inquiry |
| Apob-493M | Recombinant Mouse Apob protein, His-tagged | +Inquiry |
| APOB-128H | Recombinant Human APOB protein, GST-tagged | +Inquiry |
| APOB-2534H | Recombinant Human APOB protein, His-SUMO-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOB-26875TH | Native Human APOB | +Inquiry |
| APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
| APOB-1H | Native Human Apolipoprotein B | +Inquiry |
| APOB-8037H | Native Human Plasma APOB | +Inquiry |
| APOB-216H | Native Human APOB Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOB Products
Required fields are marked with *
My Review for All APOB Products
Required fields are marked with *



