Recombinant Human APOC1 protein, GST-tagged

Cat.No. : APOC1-311H
Product Overview : Recombinant Human APOC1 protein(NP_001636)(1-83 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-83 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name APOC1 apolipoprotein C-I [ Homo sapiens ]
Official Symbol APOC1
Synonyms APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1;
Gene ID 341
mRNA Refseq NM_001645
Protein Refseq NP_001636
MIM 107710
UniProt ID P02654

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOC1 Products

Required fields are marked with *

My Review for All APOC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon