Recombinant Human APOC1 protein, GST-tagged
Cat.No. : | APOC1-311H |
Product Overview : | Recombinant Human APOC1 protein(NP_001636)(1-83 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-83 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | APOC1 apolipoprotein C-I [ Homo sapiens ] |
Official Symbol | APOC1 |
Synonyms | APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; |
Gene ID | 341 |
mRNA Refseq | NM_001645 |
Protein Refseq | NP_001636 |
MIM | 107710 |
UniProt ID | P02654 |
◆ Recombinant Proteins | ||
APOC1-2537H | Recombinant Human APOC1 protein, N/A-tagged | +Inquiry |
APOC1-1787M | Recombinant Mouse APOC1 Protein | +Inquiry |
Apoc1-303M | Recombinant Mouse Apoc1 protein, His-GST-tagged | +Inquiry |
APOC1-379R | Recombinant Rat APOC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOC1-2536H | Recombinant Human APOC1 protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC1-97HCL | Recombinant Human APOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC1 Products
Required fields are marked with *
My Review for All APOC1 Products
Required fields are marked with *
0
Inquiry Basket