Recombinant Mouse Apoc1 protein, His-tagged

Cat.No. : Apoc1-2353M
Product Overview : Recombinant Mouse Apoc1 protein(P34928)(27-88aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 27-88aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12.5 kDa
AA Sequence : APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Apoc1 apolipoprotein C-I [ Mus musculus ]
Official Symbol Apoc1
Synonyms APOC1; apolipoprotein C-I; apo-CI; apoC-I; apolipoprotein C1; Apo-CIB; ApoC-IB;
Gene ID 11812
mRNA Refseq NM_001110009
Protein Refseq NP_001103479

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Apoc1 Products

Required fields are marked with *

My Review for All Apoc1 Products

Required fields are marked with *

0
cart-icon