Recombinant Mouse Apoc1 protein, His-tagged
Cat.No. : | Apoc1-2353M |
Product Overview : | Recombinant Mouse Apoc1 protein(P34928)(27-88aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-88aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.5 kDa |
AA Sequence : | APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Apoc1 apolipoprotein C-I [ Mus musculus ] |
Official Symbol | Apoc1 |
Synonyms | APOC1; apolipoprotein C-I; apo-CI; apoC-I; apolipoprotein C1; Apo-CIB; ApoC-IB; |
Gene ID | 11812 |
mRNA Refseq | NM_001110009 |
Protein Refseq | NP_001103479 |
◆ Recombinant Proteins | ||
APOC1-302H | Recombinant Human APOC1 Protein, His-tagged | +Inquiry |
APOC1-379R | Recombinant Rat APOC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Apoc1-816M | Recombinant Mouse Apoc1 Protein, MYC/DDK-tagged | +Inquiry |
APOC1-723R | Recombinant Rat APOC1 Protein | +Inquiry |
APOC1-311H | Recombinant Human APOC1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC1-97HCL | Recombinant Human APOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoc1 Products
Required fields are marked with *
My Review for All Apoc1 Products
Required fields are marked with *