Recombinant Human APOC2 Protein, His-tagged
Cat.No. : | APOC2-916H |
Product Overview : | Recombinant Human APOC2 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. |
Form : | Supplied as a 0.2 µM filtered solution of PBS, 30%glycerol, pH7.4 |
Molecular Mass : | 10kD |
AA Sequence : | MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | APOC2 apolipoprotein C-II [ Homo sapiens ] |
Official Symbol | APOC2 |
Synonyms | APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082; |
Gene ID | 344 |
mRNA Refseq | NM_000483 |
Protein Refseq | NP_000474 |
MIM | 608083 |
UniProt ID | P02655 |
◆ Recombinant Proteins | ||
Apoc2-222R | Recombinant Rat Apoc2 Protein, His-tagged | +Inquiry |
Apoc2-817M | Recombinant Mouse Apoc2 Protein, MYC/DDK-tagged | +Inquiry |
APOC2-304C | Recombinant Cynomolgus APOC2 Protein, His-tagged | +Inquiry |
Apoc2-3569C | Recombinant Cavia porcellus (Guinea pig) Apoc2, GST-tagged | +Inquiry |
APOC2-362H | Recombinant Human APOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC2-8783HCL | Recombinant Human APOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC2 Products
Required fields are marked with *
My Review for All APOC2 Products
Required fields are marked with *
0
Inquiry Basket