Recombinant Human APOH protein(119-345aa), His-GST-tagged

• Cat.No.: APOH-9821H
• Product Overview: Recombinant Human APOH protein(P02749)(119-345aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 119-345aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Gene Information

• Gene Name: APOH apolipoprotein H (beta-2-glycoprotein I) [ Homo sapiens ]
• Official Symbol: APOH
• Synonyms: APOH; apolipoprotein H (beta-2-glycoprotein I); B2G1; beta-2-glycoprotein 1; beta 2 glycoprotein I; BG; B2GPI; apo-H; beta(2)GPI; APC inhibitor; anticardiolipin cofactor; activated protein C-binding protein; B2GP1
• Gene ID: 350
• mRNA Refseq: NM_000042
• Protein Refseq: NP_000033
• MIM: 138700
• UniProt ID: P02749