Recombinant Human APOL4 protein, GST-tagged
Cat.No. : | APOL4-714H |
Product Overview : | Human APOL4 full-length ORF ( ENSP00000331089, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOL4 apolipoprotein L, 4 [ Homo sapiens ] |
Official Symbol | APOL4 |
Synonyms | APOL4; apolipoprotein L, 4; apolipoprotein L4; APOLIV; apolipoprotein L-IV; APOL-IV; |
Gene ID | 80832 |
mRNA Refseq | NM_030643 |
Protein Refseq | NP_085146 |
MIM | 607254 |
UniProt ID | Q9BPW4 |
◆ Recombinant Proteins | ||
APOL4-714H | Recombinant Human APOL4 protein, GST-tagged | +Inquiry |
APOL4-1331HF | Recombinant Full Length Human APOL4 Protein, GST-tagged | +Inquiry |
APOL4-15908H | Recombinant Human APOL4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOL4-99HCL | Recombinant Human APOL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOL4 Products
Required fields are marked with *
My Review for All APOL4 Products
Required fields are marked with *
0
Inquiry Basket