Recombinant Human APOL4 protein, GST-tagged

Cat.No. : APOL4-714H
Product Overview : Human APOL4 full-length ORF ( ENSP00000331089, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.7 kDa
AA Sequence : MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOL4 apolipoprotein L, 4 [ Homo sapiens ]
Official Symbol APOL4
Synonyms APOL4; apolipoprotein L, 4; apolipoprotein L4; APOLIV; apolipoprotein L-IV; APOL-IV;
Gene ID 80832
mRNA Refseq NM_030643
Protein Refseq NP_085146
MIM 607254
UniProt ID Q9BPW4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOL4 Products

Required fields are marked with *

My Review for All APOL4 Products

Required fields are marked with *

0
cart-icon